PDB entry 1cjb

View 1cjb on RCSB PDB site
Description: malarial purine phosphoribosyltransferase
Deposited on 1999-04-08, released 1999-08-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-01, with a file datestamp of .
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cjba_
  • Chain 'B':
    Domains in SCOP 1.55: d1cjbb_
  • Chain 'C':
    Domains in SCOP 1.55: d1cjbc_
  • Chain 'D':
    Domains in SCOP 1.55: d1cjbd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjbA (A:)
    pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
    kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
    tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
    ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjbB (B:)
    pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
    kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
    tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
    ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjbC (C:)
    pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
    kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
    tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
    ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykatsl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjbD (D:)
    pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
    kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
    tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
    ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat