PDB entry 1cjb

View 1cjb on RCSB PDB site
Description: malarial purine phosphoribosyltransferase
Class: transferase
Keywords: malaria, purine salvage, phosphoribosyltransferase, transition state inhibitor, transferase
Deposited on 1999-04-08, released 1999-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hypoxanthine-guanine phosphoribosyltransferase)
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjba_
  • Chain 'B':
    Compound: protein (hypoxanthine-guanine phosphoribosyltransferase)
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjbb_
  • Chain 'C':
    Compound: protein (hypoxanthine-guanine phosphoribosyltransferase)
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjbc_
  • Chain 'D':
    Compound: protein (hypoxanthine-guanine phosphoribosyltransferase)
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjbd_
  • Heterogens: MG, IRP, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjbA (A:)
    mpipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklayd
    ikkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndq
    stgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtpl
    wngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykatsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjbA (A:)
    pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
    kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
    tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
    ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cjbB (B:)
    mpipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklayd
    ikkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndq
    stgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtpl
    wngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykatsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjbB (B:)
    pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
    kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
    tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
    ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cjbC (C:)
    mpipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklayd
    ikkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndq
    stgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtpl
    wngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykatsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjbC (C:)
    pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
    kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
    tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
    ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykatsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cjbD (D:)
    mpipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklayd
    ikkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndq
    stgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtpl
    wngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykatsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjbD (D:)
    pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
    kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
    tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
    ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat