PDB entry 1cja

View 1cja on RCSB PDB site
Description: actin-fragmin kinase, catalytic domain from physarum polycephalum
Class: transferase
Keywords: kinase, actin, transferase
Deposited on 1999-04-08, released 1999-06-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.198
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (actin-fragmin kinase)
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cjaa_
  • Chain 'B':
    Compound: protein (actin-fragmin kinase)
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cjab_
  • Heterogens: AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjaA (A:)
    agalweiekelftklpapssainshlqpakpkvpqkkpskwdppaefkvdlstavsyndi
    gdinwknlqqfkgiersekgteglffvetesgvfivkrstniesetfcsllcmrlglhap
    kvrvvssnseegtnmleclaaidksfrvittlanqanillmelvrgitlnkltttsapev
    ltkstmqqlgslmaldvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldas
    hphgervrellrtliahpghessqfhsirdiitlytgydvgtegsismqegflatvreca
    sfdldaferellswqeslqkchnlsispqaipfilrmlrifh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjaA (A:)
    agalweiekelftklpapssainshlqpakpfkvdlstavsyndigdinwknlqqfkgie
    rsekgteglffvetesgvfivkrstniesetfcsllcmrlglhapkvrvvssnseegtnm
    leclaaidksfrvittlanqanillmelvrgitlnkltttsapevltkstmqqlgslmal
    dvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldashphgervrellrtli
    ahpghessqfhsirdiitlytgydvgtegsismqegflatvrecasfdldaferellswq
    eslqkchnlsispqaipfilrmlrifh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cjaB (B:)
    agalweiekelftklpapssainshlqpakpkvpqkkpskwdppaefkvdlstavsyndi
    gdinwknlqqfkgiersekgteglffvetesgvfivkrstniesetfcsllcmrlglhap
    kvrvvssnseegtnmleclaaidksfrvittlanqanillmelvrgitlnkltttsapev
    ltkstmqqlgslmaldvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldas
    hphgervrellrtliahpghessqfhsirdiitlytgydvgtegsismqegflatvreca
    sfdldaferellswqeslqkchnlsispqaipfilrmlrifh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjaB (B:)
    agalweiekelftklpapssainshlqpakpfkvdlstavsyndigdinwknlqqfkgie
    rsekgteglffvetesgvfivkrstniesetfcsllcmrlglhapkvrvvssnseegtnm
    leclaaidksfrvittlanqanillmelvrgitlnkltttsapevltkstmqqlgslmal
    dvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldashphgervrellrtli
    ahpghessqfhsirdiitlytgydvgtegsismqegflatvrecasfdldaferellswq
    eslqkchnlsispqaipfilrmlrifh