PDB entry 1cj9

View 1cj9 on RCSB PDB site
Description: t40v mutant human lysozyme
Class: hydrolase
Keywords: stability, hydrogen bond
Deposited on 1999-04-22, released 1999-04-30
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • mutation (39)
    Domains in SCOP 1.75: d1cj9a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj9A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgynvratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv