PDB entry 1cj9

View 1cj9 on RCSB PDB site
Description:
Deposited on 1999-04-22, released 1999-04-30
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-15, with a file datestamp of 1999-12-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1cj9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj9A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgynvratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv