PDB entry 1cj5

View 1cj5 on RCSB PDB site
Description: bovine beta-lactoglobulin a
Deposited on 1999-04-22, released 2000-04-26
The last revision prior to the SCOP 1.71 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1cj5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj5A (A:)
    ayvtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi