PDB entry 1cj5

View 1cj5 on RCSB PDB site
Description: bovine beta-lactoglobulin a
Class: transport protein
Keywords: beta-lactoglobulin a, dynamics, transport protein
Deposited on 1999-04-22, released 2000-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin a
    Species: Bos taurus [TaxId:9913]
    Gene: BLG CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754 (2-161)
      • insertion (0-1)
      • conflict (104)
    Domains in SCOPe 2.08: d1cj5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj5A (A:)
    ayvtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi