PDB entry 1cj3

View 1cj3 on RCSB PDB site
Description: mutant tyr38glu of para-hydroxybenzoate hydroxylase
Class: oxidoreductase
Keywords: oxidoreductase, hydroxybenzoate
Deposited on 1999-04-21, released 1999-04-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.161
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (p-hydroxybenzoate hydroxylase)
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: POBA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00438 (0-391)
      • engineered mutation (37)
      • engineered mutation (115)
    Domains in SCOPe 2.05: d1cj3a1, d1cj3a2
  • Heterogens: FAD, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj3A (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdevlgriragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
    telkarlpaevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyee