PDB entry 1cj0

View 1cj0 on RCSB PDB site
Description: crystal structure of rabbit cytosolic serine hydroxymethyltransferase at 2.8 angstrom resolution
Class: transferase
Keywords: hydroxymethyl transferase, 1 carbon metabolism, transferase
Deposited on 1999-04-20, released 1999-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (serine hydroxymethyltransferase)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj0a_
  • Chain 'B':
    Compound: protein (serine hydroxymethyltransferase)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj0b_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cj0A (A:)
    wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
    egypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
    hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
    pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
    thktlrgcragmifyrrgvrsvdpktgkeilynleslinsavfpglqggphnhaiagvav
    alkqamtpefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggrae
    kvleacsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvq
    iqddtgpratlkefkeklagdekhqravralrqevesfaalfplpglpgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cj0A (A:)
    wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
    egypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
    hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
    pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
    thktlrgcragmifyrrgvrsvdilynleslinsavfpglqggphnhaiagvavalkqam
    tpefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggraekvleac
    siacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvqiqddtg
    pratlkefkeklagdekhqravralrqevesfaalfplpglpgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cj0B (B:)
    wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
    egypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
    hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
    pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
    thktlrgcragmifyrrgvrsvdpktgkeilynleslinsavfpglqggphnhaiagvav
    alkqamtpefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggrae
    kvleacsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvq
    iqddtgpratlkefkeklagdekhqravralrqevesfaalfplpglpgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cj0B (B:)
    wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
    egypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
    hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
    pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
    thktlrgcragmifyrrgvrsvdkeilynleslinsavfpglqggphnhaiagvavalkq
    amtpefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggraekvle
    acsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvqiqdd
    tgpratlkefkeklagdekhqravralrqevesfaalfplpglpgf