PDB entry 1ciy

View 1ciy on RCSB PDB site
Description: insecticidal toxin: structure and channel formation
Class: toxin
Keywords: toxin, delta-endotoxin cryia(a), icp
Deposited on 1995-06-01, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.163
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cryia(a)
    Species: Bacillus thuringiensis [TaxId:1428]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ciya1, d1ciya2, d1ciya3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ciyA (A:)
    ietgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqri
    eefarnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaipll
    avqnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyav
    rwyntglervwgpdsrdwvrynqfrreltltvldivalfsnydsrrypirtvsqltreiy
    tnpvlenfdgsfrgmaqrieqnirqphlmdilnsitiytdvhrgfnywsghqitaspvgf
    sgpefafplfgnagnaappvlvsltglgifrtlssplyrriilgsgpnnqelfvldgtef
    sfaslttnlpstiyrqrgtvdsldvippqdnsvppragfshrlshvtmlsqaagavytlr
    aptfswqhrsaefnniipssqitqipltkstnlgsgtsvvkgpgftggdilrrtspgqis
    tlrvnitaplsqryrvriryasttnlqfhtsidgrpinqgnfsatmssgsnlqsgsfrtv
    gfttpfnfsngssvftlsahvfnsgnevyidriefvpaevtfeaeydler
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ciyA (A:)
    ytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieefa
    rnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaipllavqn
    yqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwyn
    tglervwgpdsrdwvrynqfrreltltvldivalfsnydsrrypirtvsqltreiytnpv
    lenfdgsfrgmaqrieqnirqphlmdilnsitiytdvhrgfnywsghqitaspvgfsgpe
    fafplfgnagnaappvlvsltglgifrtlssplyrriilgsgpnnqelfvldgtefsfas
    lttnlpstiyrqrgtvdsldvippqdnsvppragfshrlshvtmlsqaagavytlraptf
    swqhrsaefnniipssqitqipltkstnlgsgtsvvkgpgftggdilrrtspgqistlrv
    nitaplsqryrvriryasttnlqfhtsidgrpinqgnfsatmssgsnlqsgsfrtvgftt
    pfnfsngssvftlsahvfnsgnevyidriefvpaevt