PDB entry 1ciu

View 1ciu on RCSB PDB site
Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.
Class: glycosidase
Keywords: thermostable, glycosidase
Deposited on 1995-10-23, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glycosyltransferase
    Species: Thermoanaerobacterium thermosulfurigenes [TaxId:33950]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ciua1, d1ciua2, d1ciua3, d1ciua4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ciuA (A:)
    asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
    indgyltgmgvtaiwisqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
    nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
    gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
    knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
    mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
    gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiaygttqqrwinndvyi
    yerkfgnnvalvainrnlstsynitglytalpagtytdvlggllngnsisvasdgsvtpf
    tlsagevavwqyvsssnsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivs
    wddtevkvkvpsvtpgkynislktssgatsntynniniltgnqicvrfvvnnastvygen
    vyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvsvpagttiqfkfikkngntitwe
    ggsnhtytvpssstgtvivnwqq