PDB entry 1cit

View 1cit on RCSB PDB site
Description: dna-binding mechanism of the monomeric orphan nuclear receptor ngfi-b
Deposited on 1999-04-05, released 1999-05-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-26, with a file datestamp of 2000-06-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cita_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1citA (A:)
    grcavcgdnascqhygvrtcegckgffkrtvqksakyiclankdcpvdkrrrnrcqfcrf
    qkclavgmvkevvrtdslkgrrgrlpskp