PDB entry 1cit

View 1cit on RCSB PDB site
Description: DNA-binding mechanism of the monomeric orphan nuclear receptor ngfi-b
Class: transcription/DNA
Keywords: orphan nuclear receptor, early immediate response gene product, transcription factor, monomeric protein-DNA complex, minor groove interactions, protein/DNA, transcription/DNA complex
Deposited on 1999-04-05, released 1999-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (orphan nuclear receptor ngfi-b)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cita_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*cp*gp*ap*ap*ap*ap*gp*gp*tp*cp*ap*tp*gp*cp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*gp*cp*ap*tp*gp*ap*cp*cp*tp*tp*tp*tp*cp*gp*g)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1citA (A:)
    grcavcgdnascqhygvrtcegckgffkrtvqksakyiclankdcpvdkrrrnrcqfcrf
    qkclavgmvkevvrtdslkgrrgrlpskp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.