PDB entry 1cis

View 1cis on RCSB PDB site
Description: context dependence of protein secondary structure formation. the three-dimensional structure and stability of a hybrid between chymotrypsin inhibitor 2 and helix e from subtilisin carlsberg
Class: hybrid protein
Keywords: hybrid protein
Deposited on 1993-04-23, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hybrid protein formed from chymotrypsin inhibitor-2
  Species: Hordeum vulgare, Bacillus licheniformis [TaxId:4513, 1402]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01053 (1-65)
    • insertion (32-33)
    • conflict (34-41)
    • conflict (51)
  Domains in SCOPe 2.08: d1cisa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cisA (A:)
  mktewpelvgksveeakkvilqdkpeaqiivlekqavdnayaeyridrvrlavdkldnia
  qvprvg