PDB entry 1cir

View 1cir on RCSB PDB site
Description: complex of two fragments of ci2 [(1-40)(dot)(41-64)]
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1995-10-02, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsin inhibitor 2
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cir.1
  • Chain 'B':
    Compound: chymotrypsin inhibitor 2
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cir.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cirA (A:)
    mktewpelvgksveeakkvilqdkpeaqiivlpvgtivts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cirA (A:)
    mktewpelvgksveeakkvilqdkpeaqiivlpvgtivt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cirB (B:)
    eyridrvrlfvdkldniaqvprvg