PDB entry 1cir

View 1cir on RCSB PDB site
Description: complex of two fragments of ci2 [(1-40)(dot)(41-64)]
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1995-10-02, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chymotrypsin inhibitor 2
  Species: Hordeum vulgare [TaxId:4513]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01053 (1-38)
  Domains in SCOPe 2.08: d1cir.1
• Chain 'B':
  Compound: chymotrypsin inhibitor 2
  Species: Hordeum vulgare [TaxId:4513]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01053 (0-23)
  Domains in SCOPe 2.08: d1cir.1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1cirA (A:)
  mktewpelvgksveeakkvilqdkpeaqiivlpvgtivts
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1cirA (A:)
  mktewpelvgksveeakkvilqdkpeaqiivlpvgtivt
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cirB (B:)
  eyridrvrlfvdkldniaqvprvg