PDB entry 1ciq

View 1ciq on RCSB PDB site
Description: complex of two fragments of ci2, residues 1-40 and 41-64
Class: serine protease inhibitor
Keywords: cleaved inhibitor, serine protease inhibitor
Deposited on 1995-10-02, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chymotrypsin inhibitor 2
  Species: Hordeum vulgare [TaxId:4513]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01053 (1-End)
  Domains in SCOPe 2.07: d1ciq.1
• Chain 'B':
  Compound: chymotrypsin inhibitor 2
  Species: Hordeum vulgare [TaxId:4513]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01053 (0-23)
  Domains in SCOPe 2.07: d1ciq.1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ciqA (A:)
  mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtm
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ciqA (A:)
  ktewpelvgksveeakkvilqdkpeaqiivlpvgtiv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ciqB (B:)
  eyridrvrlfvdkldniaqvprvg