PDB entry 1ciq
View 1ciq on RCSB PDB site
Description: complex of two fragments of ci2, residues 1-40 and 41-64
Class: serine protease inhibitor
Keywords: cleaved inhibitor, serine protease inhibitor
Deposited on
1995-10-02, released
1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: chymotrypsin inhibitor 2
Species: Hordeum vulgare [TaxId:4513]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1ciq.1 - Chain 'B':
Compound: chymotrypsin inhibitor 2
Species: Hordeum vulgare [TaxId:4513]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1ciq.1 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1ciqA (A:)
mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtm
Sequence, based on observed residues (ATOM records): (download)
>1ciqA (A:)
ktewpelvgksveeakkvilqdkpeaqiivlpvgtiv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ciqB (B:)
eyridrvrlfvdkldniaqvprvg