PDB entry 1ciq

View 1ciq on RCSB PDB site
Description: complex of two fragments of ci2, residues 1-40 and 41-64
Class: serine protease inhibitor
Keywords: cleaved inhibitor, serine protease inhibitor
Deposited on 1995-10-02, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsin inhibitor 2
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ciq.1
  • Chain 'B':
    Compound: chymotrypsin inhibitor 2
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ciq.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ciqA (A:)
    mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ciqA (A:)
    ktewpelvgksveeakkvilqdkpeaqiivlpvgtiv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ciqB (B:)
    eyridrvrlfvdkldniaqvprvg