PDB entry 1cik

View 1cik on RCSB PDB site
Description: recombinant sperm whale myoglobin i99a mutant (met)
Deposited on 1999-04-01, released 1999-04-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-09, with a file datestamp of 2001-04-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.151
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cika_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cikA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkapikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg