PDB entry 1cij

View 1cij on RCSB PDB site
Description: haloalkane dehalogenase soaked with high concentration of bromide
Class: hydrolase
Keywords: dehalogenase, collision complex, alpha/beta-hydrolase
Deposited on 1999-03-31, released 1999-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (haloalkane dehalogenase)
    Species: Xanthobacter autotrophicus [TaxId:280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22643 (0-309)
      • expression tag (1)
    Domains in SCOPe 2.07: d1cija_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cijA (A:)
    mvnairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
    ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
    vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlv
    tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
    isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
    ealkhfaete