PDB entry 1cii

View 1cii on RCSB PDB site
Description: colicin ia
Class: transmembrane protein
Keywords: colicin, bacteriocin, ion channel formation, transmembrane protein
Deposited on 1997-01-08, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.241
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin ia
    Species: Escherichia coli [TaxId:562]
    Gene: cia
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ciia1, d1ciia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ciiA (A:)
    eimavdiyvnpprvdvfhgtppawssfgnktiwggnewvddsptrsdiekrdkeitaykn
    tlsaqqkenenkrteagkrlsaaiaarekdentlktlragnadaaditrqefrllqaelr
    eygfrteiagydalrlhtesrmlfadadslrisprearslieqaekrqkdaqnadkkaad
    mlaeyerrkgildtrlseleknggaalavldaqqarllgqqtrndraisearnklssvte
    slntarnaltraeqqltqqkntpdgktivspekfpgrsstndsivvsgdprfagtikitt
    savidnranlnyllshsgldykrnilndrnpvvtedvegdkkiynaevaewdklrqrlld
    arnkitsaesavnsarnnlsartneqkhandalnallkekenirnqlsginqkiaeekrk
    qdelkatkdainftteflksvsekygakaeqlaremagqakgkkirnveealktyekyra
    dinkkinakdraaiaaalesvklsdissnlnrfsrglgyagkftsladwitefgkavrte
    nwrplfvktetiiagnaatalvalvfsiltgsalgiigygllmavtgalideslvekank
    fw