PDB entry 1cic

View 1cic on RCSB PDB site
Description:
Deposited on 1999-03-31, released 1999-04-19
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-11, with a file datestamp of 2003-03-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cica1, d1cica2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cicb1, d1cicb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cicc1, d1cicc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cicd1, d1cicd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicA (A:)
    divmtqshkfmstsvgdrvsitckasqdvriavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqhcgsypftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicB (B:)
    qvqlqqpgselvrpgasvklsckasgytftnywmhwvkqrpgqglewigniypgsgdsny
    dekfkskatltvdtssstaymqlsgltsedsavyycarglafyfdhwgqgttltvssalt
    tppsvyplapgcgdttgssvtlgclvkgyfpepvtvtwnsgslsssvhtfpallqsglyt
    msssvtvpsstwpsetvtcsvahpassttvdkkleps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicC (C:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicD (D:)
    qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
    salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvssastt
    ppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpssprpsetvtcnvahpasstkvdkkivprdc