PDB entry 1cic

View 1cic on RCSB PDB site
Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225
Class: immunoglobulin
Keywords: immunoglobulin, fab complex, idiotope, anti-idiotope
Deposited on 1999-03-31, released 1999-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ig heavy chain v regions)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cica1, d1cica2
  • Chain 'B':
    Compound: protein (ig heavy chain v regions)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cicb1, d1cicb2
  • Chain 'C':
    Compound: protein (ig heavy chain v regions)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cicc1, d1cicc2
  • Chain 'D':
    Compound: protein (ig heavy chain v regions)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cicd1, d1cicd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicA (A:)
    divmtqshkfmstsvgdrvsitckasqdvriavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqhcgsypftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicB (B:)
    qvqlqqpgselvrpgasvklsckasgytftnywmhwvkqrpgqglewigniypgsgdsny
    dekfkskatltvdtssstaymqlsgltsedsavyycarglafyfdhwgqgttltvssalt
    tppsvyplapgcgdttgssvtlgclvkgyfpepvtvtwnsgslsssvhtfpallqsglyt
    msssvtvpsstwpsetvtcsvahpassttvdkkleps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicC (C:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cicD (D:)
    qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
    salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvssastt
    ppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpssprpsetvtcnvahpasstkvdkkivprdc