PDB entry 1cia

View 1cia on RCSB PDB site
Description: replacement of catalytic histidine-195 of chloramphenicol acetyltransferase: evidence for a general base role for glutamate
Class: transferase(acyltransferase)
Keywords: transferase(acyltransferase)
Deposited on 1993-07-19, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.131
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chloramphenicol acetyltransferase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00484 (0-212)
    • conflict (188)
  Domains in SCOPe 2.08: d1ciaa_
• Heterogens: CO, BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ciaA (A:)
  mnytkfdvknwvrrehfefyrhrlpcgfsltskidittlkkslddsaykfypvmiyliaq
  avnqfdelrmaikddelivwdsvdpqftvfhqetetfsalscpyssdidqfmvnylsvme
  ryksdtklfpqgvtpenhlnisalpwvnfdsfnlnvanftdyfapiitmakyqqegdrll
  lplsvqvhqavcdgfhvarfinrlqelcnsklk