PDB entry 1ci8

View 1ci8 on RCSB PDB site
Description: esterase estb from burkholderia gladioli: an esterase with (beta)- lactamase fold.
Deposited on 1999-04-08, released 2001-12-12
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ci8a_
  • Chain 'B':
    Domains in SCOP 1.59: d1ci8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ci8A (A:)
    aaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladreagrpmredtlfrla
    svtkpivalavlrlvargelaldapvtrwlpefrprladgseplvtihhllthtsglgyw
    llegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwqyslaldvlgavver
    atgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvrmrdgievplpeghg
    aavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpetladaarrdqagvg
    aetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdralglsvllltntay
    egmsgpltialrdavya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ci8B (B:)
    aaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladreagrpmredtlfrla
    svtkpivalavlrlvargelaldapvtrwlpefrprladgseplvtihhllthtsglgyw
    llegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwqyslaldvlgavver
    atgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvrmrdgievplpeghg
    aavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpetladaarrdqagvg
    aetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdralglsvllltntay
    egmsgpltialrdavya