PDB entry 1ci8

View 1ci8 on RCSB PDB site
Description: esterase estb from burkholderia gladioli: an esterase with (beta)-lactamase fold.
Class: hydrolase
Keywords: esterase, lactamase fold, hydrolase
Deposited on 1999-04-08, released 2001-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (carboxylesterase)
    Species: Burkholderia gladioli [TaxId:28095]
    Gene: ESTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci8a_
  • Chain 'B':
    Compound: protein (carboxylesterase)
    Species: Burkholderia gladioli [TaxId:28095]
    Gene: ESTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci8b_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ci8A (A:)
    mtaasldptafsldaaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladre
    agrpmredtlfrlasvtkpivalavlrlvargelaldapvtrwlpefrprladgseplvt
    ihhllthtsglgywllegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwq
    yslaldvlgavveratgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvr
    mrdgievplpeghgaavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpe
    tladaarrdqagvgaetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdr
    alglsvllltntayegmsgpltialrdavyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci8A (A:)
    aaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladreagrpmredtlfrla
    svtkpivalavlrlvargelaldapvtrwlpefrprladgseplvtihhllthtsglgyw
    llegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwqyslaldvlgavver
    atgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvrmrdgievplpeghg
    aavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpetladaarrdqagvg
    aetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdralglsvllltntay
    egmsgpltialrdavya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ci8B (B:)
    mtaasldptafsldaaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladre
    agrpmredtlfrlasvtkpivalavlrlvargelaldapvtrwlpefrprladgseplvt
    ihhllthtsglgywllegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwq
    yslaldvlgavveratgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvr
    mrdgievplpeghgaavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpe
    tladaarrdqagvgaetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdr
    alglsvllltntayegmsgpltialrdavyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci8B (B:)
    aaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladreagrpmredtlfrla
    svtkpivalavlrlvargelaldapvtrwlpefrprladgseplvtihhllthtsglgyw
    llegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwqyslaldvlgavver
    atgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvrmrdgievplpeghg
    aavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpetladaarrdqagvg
    aetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdralglsvllltntay
    egmsgpltialrdavya