PDB entry 1ci7

View 1ci7 on RCSB PDB site
Description: ternary complex of thymidylate synthase from pneumocystis carinii
Class: transferase
Keywords: methyltransferase, nucleotide biosynthesis, half-sites reactivity
Deposited on 1999-04-08, released 2000-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (thymidylate synthase)
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci7a_
  • Chain 'B':
    Compound: protein (thymidylate synthase)
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci7b_
  • Heterogens: UMP, CB3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ci7A (A:)
    mvnaeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfir
    gvieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhf
    gaeyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfy
    vhipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdch
    iykdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci7A (A:)
    naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
    ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
    eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
    ipsrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiykdh
    iealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ci7B (B:)
    mvnaeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfir
    gvieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhf
    gaeyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfy
    vhipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdch
    iykdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci7B (B:)
    naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
    ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
    eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
    ipsrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiykdh
    iealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi