PDB entry 1ci6

View 1ci6 on RCSB PDB site
Description: transcription factor atf4-c/ebp beta bzip heterodimer
Class: transcription
Keywords: transcription factor, bzip
Deposited on 1999-04-07, released 2000-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor atf-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci6a_
  • Chain 'B':
    Compound: transcription factor c/ebp beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci6b_
  • Heterogens: FE, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ci6A (A:)
    mkklkkmeqnktaatryrqkkraeqealtgeckelekknealkeradslakeiqylkdli
    eev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci6A (A:)
    eqnktaatryrqkkraeqealtgeckelekknealkeradslakeiqylkdlieev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ci6B (B:)
    meykmrrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlf
    kql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci6B (B:)
    srdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfkql