PDB entry 1ci5

View 1ci5 on RCSB PDB site
Description: glycan-free mutant adhesion domain of human cd58 (lfa-3)
Deposited on 1999-04-07, released 1999-06-22
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-22, with a file datestamp of 1999-06-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ci5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ci5A (A:)
    ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
    sltiynltssdedeyemespnitdsmkfflyvges