PDB entry 1ci5

View 1ci5 on RCSB PDB site
Description: glycan-free mutant adhesion domain of human cd58 (lfa-3)
Class: immune system
Keywords: adhesion glycoprotein, immunoglobulin superfamily v-set domain, cell surface receptor, immune system
Deposited on 1999-04-07, released 1999-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lymphocyte function-associated antigen 3(cd58))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19256 (0-94)
      • engineered mutation (0)
      • engineered mutation (8)
      • engineered mutation (20)
      • engineered mutation (57)
      • engineered mutation (84)
      • engineered mutation (92)
    Domains in SCOPe 2.08: d1ci5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ci5A (A:)
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges