PDB entry 1ci3

View 1ci3 on RCSB PDB site
Description: cytochrome f from the b6f complex of phormidium laminosum
Class: electron transport
Keywords: electron transfer protein, complex subunit, electron transport
Deposited on 1999-04-07, released 1999-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: protein (cytochrome f)
    Species: Phormidium laminosum [TaxId:32059]
    Gene: PETA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci3m1, d1ci3m2
  • Heterogens: ZN, HEM, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ci3M (M:)
    ypfwaqqnyanpreatgrivcanchlaakpaeievpqavlpdsvfkavvkipydhsvqqv
    qadgskgplnvgavlmlpegftiapedripeemkeevgpsylfqpyaddkqnivlvgplp
    gdeyeeivfpvlspnpatnksvafgkysihlganrgrgqiyptgeksnnavynasaagvi
    taiakaddgsaevkirtedgttivdkipagpelivsegeevaagaaltnnpnvggfgqkd
    teivlqspn