PDB entry 1ci2

View 1ci2 on RCSB PDB site
Description: crystal and molecular structure of the serine proteinase inhibitor /ci$-2 from barley seeds
Deposited on 1988-02-06, released 1988-07-16
The last revision was dated 1993-07-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    no info in PDB for this chain
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1ci2I (I:)
    zvsskkpegvntgagdrhnlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtme
    yridrvrlfvdkldniaevprvg
    

    Sequence, based on observed residues (ATOM records):
    >1ci2I (I:)
    nlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniae
    vprvg