PDB entry 1ci1

View 1ci1 on RCSB PDB site
Description: crystal structure of triosephosphate isomerase from trypanosoma cruzi in hexane
Class: triosephosphate isomerase
Keywords: triosephosphate isomerase, trypanosoma cruzi, organic solvent, hexane, oligomeric protein
Deposited on 1999-04-06, released 1999-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (triosephosphate isomerase)
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci1a_
  • Chain 'B':
    Compound: protein (triosephosphate isomerase)
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci1b_
  • Heterogens: HEX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ci1A (A:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaa
    gfhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvat
    pqqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslk
    pefveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci1A (A:)
    kpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfqi
    aaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagfh
    vivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpqq
    aqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpef
    veiieatk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ci1B (B:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaa
    gfhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvat
    pqqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslk
    pefveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci1B (B:)
    skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq
    iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagf
    hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
    qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
    fveiieatk