PDB entry 1ci0

View 1ci0 on RCSB PDB site
Description: pnp oxidase from saccharomyces cerevisiae
Class: oxidoreductase
Keywords: OXIDASE, B6 METABOLISM, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, OXIDOREDUCTASE
Deposited on 1999-04-06, released 1999-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pnp oxidase)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci0a_
  • Chain 'B':
    Compound: protein (pnp oxidase)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ci0b_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ci0A (A:)
    mtkqaeetqkpiifapetyqydkftlnekqltddpidlftkwfneakedpretlpeaitf
    ssaelpsgrvssrillfkeldhrgftiysnwgtsrkahdiatnpnaaivffwkdlqrqvr
    vegitehvnretseryfktrprgskigawasrqsdviknreeldeltqknterfkdaedi
    pcpdywgglrivpleiefwqgrpsrlhdrfvyrrktendpwkvvrlap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci0A (A:)
    ftlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgrvssrillfkeldhr
    gftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfktrprg
    skigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrp
    srlhdrfvyrrktendpwkvvrlap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ci0B (B:)
    mtkqaeetqkpiifapetyqydkftlnekqltddpidlftkwfneakedpretlpeaitf
    ssaelpsgrvssrillfkeldhrgftiysnwgtsrkahdiatnpnaaivffwkdlqrqvr
    vegitehvnretseryfktrprgskigawasrqsdviknreeldeltqknterfkdaedi
    pcpdywgglrivpleiefwqgrpsrlhdrfvyrrktendpwkvvrlap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci0B (B:)
    tlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgrvssrillfkeldhrg
    ftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfktrprgs
    kigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrps
    rlhdrfvyrrktendpwkvvrlap