PDB entry 1chz

View 1chz on RCSB PDB site
Description: a new neurotoxin from buthus martensii karsch
Class: toxin
Keywords: neurotoxin, scorpion, toxin
Deposited on 1999-03-31, released 2000-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bmk m2)
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1chza_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chzA (A:)
    vrdayiakphncvyecarneycnnlctkngaksgycqwsgkygngcwcielpdnvpirvp
    gkch