PDB entry 1chv

View 1chv on RCSB PDB site
Description: elucidation of the solution structure of cardiotoxin analogue v from the taiwan cobra (naja naja atra) venom
Class: toxin
Keywords: cardiotoxins, cytotoxins, toxin
Deposited on 1999-03-30, released 2000-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Compound: protein (cardiotoxin analogue v)
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1chvs_

PDB Chain Sequences:

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chvS (S:)
    lkcnklvplfyktcpagknlcykmfmvsnkmvpvkrgcidvcpkssllvkyvccntdrcn