PDB entry 1chu

View 1chu on RCSB PDB site
Description: structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
Class: flavoenzyme
Keywords: flavoenzyme, nad biosynthesis, fad, oxidoreductase
Deposited on 1999-03-29, released 1999-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (l-aspartate oxidase)
    Species: Escherichia coli [TaxId:562]
    Gene: NADB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1chua1, d1chua2, d1chua3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1chuA (A:)
    mntlpehscdvliigsgaaglslalrladqhqvivlskgpvtegstfyaqggiaavfdet
    dsidshvedtliagagicdrhavefvasnarscvqwlidqgvlfdthiqpngeesyhltr
    egghshrrilhaadatgrevettlvskalnhpnirvlertnavdlivsdkiglpgtrrvv
    gawvwnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawragcrvanlef
    nqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivaraidhe
    mkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahytcggvmvd
    dhgrtdveglyaigevsytglhganrmasnslleclvygwsaaeditrrmpyahdistlp
    pwdesrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyah
    frvsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilspgnhyinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1chuA (A:)
    ntlpehscdvliigsgaaglslalrladqhqvivlskgpvtefdetdsidshvedtliag
    agicdrhavefvasnarscvqwlidqgvlttlvskalnhpnirvlertnavdlivsdkig
    lpgtrrvvgawvwnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawrag
    crvanlefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdi
    varaidhemkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahy
    tcggvmvddhgrtdveglyaigevsytglhganrmasnslleclvygwsaaeditrrmhd
    istlppwdesrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeid
    eyyahfrvsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp