PDB entry 1chu

View 1chu on RCSB PDB site
Description: structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
Deposited on 1999-03-29, released 1999-06-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-23, with a file datestamp of 1999-06-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1chuA (A:)
    ntlpehscdvliigsgaaglslalrladqhqvivlskgpvtegstfyaqggiaavfdetd
    sidshvedtliagagicdrhavefvasnarscvqwlidqgvlfdthiqpngeesyhltre
    gghshrrilhaadatgrevettlvskalnhpnirvlertnavdlivsdkiglpgtrrvvg
    awvwnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawragcrvanlefn
    qfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivaraidhem
    krlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahytcggvmvdd
    hgrtdveglyaigevsytglhganrmasnslleclvygwsaaeditrrmpyahdistlpp
    wdesrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahf
    rvsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1chuA (A:)
    ntlpehscdvliigsgaaglslalrladqhqvivlskgpvtefdetdsidshvedtliag
    agicdrhavefvasnarscvqwlidqgvlttlvskalnhpnirvlertnavdlivsdkig
    lpgtrrvvgawvwnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawrag
    crvanlefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdi
    varaidhemkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahy
    tcggvmvddhgrtdveglyaigevsytglhganrmasnslleclvygwsaaeditrrmhd
    istlppwdesrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeid
    eyyahfrvsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp