PDB entry 1chr

View 1chr on RCSB PDB site
Description:
Deposited on 1993-08-20, released 1993-10-31
The last revision prior to the SCOP 1.67 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.195
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1chra1, d1chra2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1chrb1, d1chrb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chrA (A:)
    mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
    etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
    aellggplrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmea
    lsnslgskaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrv
    aimadeslstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmld
    stigtsvalqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtlde
    dkvrqyarvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chrB (B:)
    mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
    etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
    aellggplrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmea
    lsnslgskaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrv
    aimadeslstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmld
    stigtsvalqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtlde
    dkvrqyarvs