PDB entry 1chp

View 1chp on RCSB PDB site
Description: surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Class: toxin
Keywords: toxin
Deposited on 1995-02-15, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1chpd_
• Chain 'E':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1chpe_
• Chain 'F':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1chpf_
• Chain 'G':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1chpg_
• Chain 'H':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1chph_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chpD (D:)
  tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chpE (E:)
  tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chpF (F:)
  tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chpG (G:)
  tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chpH (H:)
  tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman