PDB entry 1chp

View 1chp on RCSB PDB site
Description: surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Class: toxin
Keywords: toxin
Deposited on 1995-02-15, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin b pentamer
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.08: d1chpd_
  • Chain 'E':
    Compound: cholera toxin b pentamer
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.08: d1chpe_
  • Chain 'F':
    Compound: cholera toxin b pentamer
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.08: d1chpf_
  • Chain 'G':
    Compound: cholera toxin b pentamer
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.08: d1chpg_
  • Chain 'H':
    Compound: cholera toxin b pentamer
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.08: d1chph_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chpD (D:)
    tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chpE (E:)
    tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chpF (F:)
    tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chpG (G:)
    tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chpH (H:)
    tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman