PDB entry 1chm

View 1chm on RCSB PDB site
Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures
Deposited on 1993-07-19, released 1994-04-30
The last revision prior to the SCOP 1.71 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chmA (A:)
    qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
    fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
    giehdhlnlqnrdklaarypdaelvdvaaacmrmrmiksaeehvmirhgariadiggaav
    vealgdqvpeyevalhatqamvraiadtfedvelmdtwtwfqsgintdgahnpvttrkvn
    kgdilslncfpmiagyytalertlfldhcsddhlrlwqvnvevheaglklikpgarcsdi
    arelneiflkhdvlqyrtfgyghsfgtlshyygreaglelredidtvlepgmvvsmepmi
    mlpeglpgaggyrehdilivnengaenitkfpygpekniir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chmB (B:)
    qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
    fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
    giehdhlnlqnrdklaarypdaelvdvaaacmrmrmiksaeehvmirhgariadiggaav
    vealgdqvpeyevalhatqamvraiadtfedvelmdtwtwfqsgintdgahnpvttrkvn
    kgdilslncfpmiagyytalertlfldhcsddhlrlwqvnvevheaglklikpgarcsdi
    arelneiflkhdvlqyrtfgyghsfgtlshyygreaglelredidtvlepgmvvsmepmi
    mlpeglpgaggyrehdilivnengaenitkfpygpekniir