PDB entry 1chm

View 1chm on RCSB PDB site
Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures
Class: creatinase
Keywords: creatinase
Deposited on 1993-07-19, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creatine amidinohydrolase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1chma1, d1chma2
  • Chain 'B':
    Compound: creatine amidinohydrolase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1chmb1, d1chmb2
  • Heterogens: CMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chmA (A:)
    qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
    fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
    giehdhlnlqnrdklaarypdaelvdvaaacmrmrmiksaeehvmirhgariadiggaav
    vealgdqvpeyevalhatqamvraiadtfedvelmdtwtwfqsgintdgahnpvttrkvn
    kgdilslncfpmiagyytalertlfldhcsddhlrlwqvnvevheaglklikpgarcsdi
    arelneiflkhdvlqyrtfgyghsfgtlshyygreaglelredidtvlepgmvvsmepmi
    mlpeglpgaggyrehdilivnengaenitkfpygpekniir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chmB (B:)
    qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
    fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
    giehdhlnlqnrdklaarypdaelvdvaaacmrmrmiksaeehvmirhgariadiggaav
    vealgdqvpeyevalhatqamvraiadtfedvelmdtwtwfqsgintdgahnpvttrkvn
    kgdilslncfpmiagyytalertlfldhcsddhlrlwqvnvevheaglklikpgarcsdi
    arelneiflkhdvlqyrtfgyghsfgtlshyygreaglelredidtvlepgmvvsmepmi
    mlpeglpgaggyrehdilivnengaenitkfpygpekniir