PDB entry 1chl

View 1chl on RCSB PDB site
Description: nmr sequential assignments and solution structure of chlorotoxin, a small scorpion toxin that blocks chloride channels
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1994-11-09, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chlorotoxin
    Species: Leiurus quinquestriatus [TaxId:6883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1chla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chlA (A:)
    mcmpcfttdhqmarkcddccggkgrgkcygpqclcr