PDB entry 1chl

View 1chl on RCSB PDB site
Description: nmr sequential assignments and solution structure of chlorotoxin, a small scorpion toxin that blocks chloride channels
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1994-11-09, released 1995-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chlorotoxin
  Species: Leiurus quinquestriatus [TaxId:6883]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45639 (0-35)
  Domains in SCOPe 2.08: d1chla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chlA (A:)
  mcmpcfttdhqmarkcddccggkgrgkcygpqclcr