PDB entry 1chk

View 1chk on RCSB PDB site
Description: streptomyces n174 chitosanase ph5.5 298k
Deposited on 1995-06-12, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1chka_
  • Chain 'B':
    Domains in SCOP 1.55: d1chkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chkA (A:)
    agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle
    lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr
    vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet
    tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chkB (B:)
    agaglddphkkeiamelvssaenssldwkaqykyiedigdgrgytggiigfcsgtgdmle
    lvqhytdlepgnilakylpalkkvngsashsglgtpftkdwataakdtvfqqaqnderdr
    vyfdpavsqakadglralgqfayydaivmhgpgndptsfggirktamkkartpaqggdet
    tylngfldarkaamlteaahddtsrvdteqrvflkagnldlnpplkwktygdpyvins