PDB entry 1chh

View 1chh on RCSB PDB site
Description: structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c
Class: electron transport(heme protein)
Keywords: electron transport(heme protein)
Deposited on 1994-06-01, released 1994-12-20
The last revision prior to the SCOP 1.75 freeze date was dated 1995-03-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • conflict (86)
      • conflict (106)
    Domains in SCOP 1.75: d1chha_
  • Heterogens: SO4, HEM, TML, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chhA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmaygglkkekdrndlitylkkate