PDB entry 1chh

View 1chh on RCSB PDB site
Description: structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c
Deposited on 1994-06-01, released 1994-12-20
The last revision prior to the SCOP 1.69 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 1.97 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1chh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chh_ (-)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmaygglkkekdrndlitylkkate