PDB entry 1chd

View 1chd on RCSB PDB site
Description: cheb methylesterase domain
Class: carboxyl methylesterase
Keywords: chemotaxis protein, serine hydrolase, carboxyl methylesterase
Deposited on 1995-03-09, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cheb methylesterase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: CHEB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1chda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1chdA (A:)
    lkagpllssekliaigastggteairhvlqplplsspaviitqhmppgftrsfaerlnkl
    cqisvkeaedgervlpghayiapgdkhmelarsganyqikihdgppvnrhrpsvdvlfhs
    vakhagrnavgviltgmgndgaagmlamyqagawtiaqneascvvfgmpreainmggvse
    vvdlsqvsqqmlakisagqairi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1chdA (A:)
    llssekliaigastggteairhvlqplplsspaviitqhmppgftrsfaerlnklcqisv
    keaedgervlpghayiapgdkhmelarsganyqikihdgppvnrhrpsvdvlfhsvakha
    grnavgviltgmgndgaagmlamyqagawtiaqneascvvfgmpreainmggvsevvdls
    qvsqqmlakisagqairi