PDB entry 1chc

View 1chc on RCSB PDB site
Description: structure of the c3hc4 domain by 1h-nuclear magnetic resonance spectroscopy; a new structural class of zinc-finger
Class: Viral protein
Keywords: Viral protein
Deposited on 1994-02-02, released 1994-04-30
The last revision prior to the SCOP 1.73 freeze date was dated 1994-04-30, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: equine herpes virus-1 ring domain
  Species: Equid herpesvirus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P28990 (0-62)
  Domains in SCOP 1.73: d1chca_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chcA (A:)
  matvaercpicledpsnysmalpclhafcyvcitrwirqnptcplckvpvesvvhtiesd
  sefgdqli