PDB entry 1chc

View 1chc on RCSB PDB site
Description: structure of the c3hc4 domain by 1h-nuclear magnetic resonance spectroscopy; a new structural class of zinc-finger
Class: Viral protein
Keywords: Viral protein
Deposited on 1994-02-02, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: equine herpes virus-1 ring domain
    Species: Equid herpesvirus 1 [TaxId:10326]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1chca_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1chcA (A:)
    matvaercpicledpsnysmalpclhafcyvcitrwirqnptcplckvpvesvvhtiesd
    sefgdqli