PDB entry 1chb

View 1chb on RCSB PDB site
Description: 2.2 angstroms crystal structure of cholera toxin b5 pentamer bound to receptor g=m1= pentasaccharide
Deposited on 1993-09-15, released 1994-01-31
The last revision was dated 1994-01-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    no info in PDB for this chain
  • Chain 'E':
    no info in PDB for this chain
  • Chain 'F':
    no info in PDB for this chain
  • Chain 'G':
    no info in PDB for this chain
  • Chain 'H':
    no info in PDB for this chain
  • Heterogens: SIA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1chbD (D:)
    mtpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records):
    >1chbD (D:)
    tpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1chbE (E:)
    mtpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records):
    >1chbE (E:)
    tpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1chbF (F:)
    mtpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records):
    >1chbF (F:)
    tpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1chbG (G:)
    mtpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records):
    >1chbG (G:)
    tpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1chbH (H:)
    mtpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkntlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records):
    >1chbH (H:)
    tpqnitdlcaeyhntqihtlnnkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkntlriaylteakveklcvwnnktphaiaaisman