PDB entry 1ch9

View 1ch9 on RCSB PDB site
Description: recombinant sperm whale myoglobin h97q mutant (met)
Class: oxygen storage/transport
Keywords: oxygen transport, heme, muscle protein, oxygen storage-transport complex
Deposited on 1999-03-31, released 1999-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (myoglobin)
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • cloning artifact (0)
      • engineered (97)
      • engineered (122)
    Domains in SCOPe 2.07: d1ch9a1, d1ch9a2
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ch9A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkqkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg